PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA60G00006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 333aa    MW: 38752.2 Da    PI: 9.7994
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA60G00006genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.7e-15453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW++eEd ll  +v+q+G++ W++++++m   ++R +k+c +rw +yl
       AA60G00006  4 RQRWSAEEDALLRAYVRQFGPREWHLVSERMSkpLNRDAKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding36.51.1e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
       AA60G00006  59 KGSLTEEEQRLVIRLQEKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.764157IPR017930Myb domain
SMARTSM007171.0E-13355IPR001005SANT/Myb domain
SuperFamilySSF466893.67E-22498IPR009057Homeodomain-like
CDDcd001671.21E-7653No hitNo description
Gene3DG3DSA:1.10.10.602.1E-20660IPR009057Homeodomain-like
PfamPF139219.7E-14768No hitNo description
SMARTSM007173.2E-1058106IPR001005SANT/Myb domain
PROSITE profilePS5129418.9958108IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-1561102IPR009057Homeodomain-like
CDDcd001671.53E-663104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MKERQRWSAE EDALLRAYVR QFGPREWHLV SERMSKPLNR DAKSCLERWK NYLKPGIKKG  60
SLTEEEQRLV IRLQEKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE HKETNKSVEP  120
IDESKYDRIL ESFAEKLVKE RSVSVGAASV AAASVMASSN GGFLHSEQSP NPVIPPWLAT  180
SNGSQQSPSQ PERAAESPGL VLGSMQPSHV IPSNESLFMS ELMECCRELE EGHRVWADHK  240
KEAAWRLRRL ELQLESEKTC RRREKMEEIE AKIKALREEQ KTAMEKIEGE YREQLVSLRR  300
DAEAKEQKLT DQWVSKHLRL TKFLEQMGCR QRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-15792789C-Myb DNA-Binding Domain
1mse_C1e-15792789C-Myb DNA-Binding Domain
1gv2_A1e-157100797MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181299.10.0transcription factor AS1
SwissprotO809310.0AS1_ARATH; Transcription factor AS1
TrEMBLD7LJW10.0D7LJW1_ARALL; Putative uncharacterized protein
TrEMBLD7LJV50.0D7LJV5_ARALL; Putative uncharacterized protein
STRINGAT2G37630.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61862740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-169MYB family protein